Cyhr1

Author: ffqa

August undefined, 2024

WebThe estimate of $40 million for the total cost of this program is based on an assumed 100 researchers leading 400 short courses for 6,000 other individuals.(12) These funds … WebHigh CYHR1 expression is associated with Esophageal Squamous Cell Carcinoma. ...

As a Novel Prognostic Marker, Cysteine/histidine-rich 1 (CYHR1) is …

WebIt's the GeneMedi's summary page for Target/Biomarker Introduction of CYHR1. The page also collects GeneMedi's different modalities and formats products for CYHR1 in therapeutics/drug discovery and IVD diagnostics, which is including antibody, ADC, bispecific, antigen, ORF vector, VLP, etc. With GeneMedi's target-insight database-GM … WebThis locus represents naturally occurring read-through transcription between the neighboring LOC84773 and cysteine and histidine rich 1 (CYHR1). It encodes a fusion protein that shares sequence identity with proteins encoded by both independent genes. [provided by RefSeq, Feb 2024] TMEM276-ZFTRAF1 TMEM276-ZFTRAF1 readthrough [ (human)] cankered in a sentence

TMEM276-ZFTRAF1 TMEM276-ZFTRAF1 readthrough [ (human)]

WebDec 17, 2015 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1... WebCysteine/histidine-rich 1 (CYHR1) was ﬁrst discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a rela- tionship between the … WebJan 1, 2005 · The bovine CYP11B1 gene is positioned in chromosomal region BTA14q12 ( Kaupe et al., 2004 ). More precisely, the CYP11B1 gene is located from 1,302,902 bp to 1,310,580 bp on chromosome 14. ...... five young cannibals she drives

PCHR - What does PCHR stand for? The Free Dictionary

CYHR1 CRISPR Knockout and Activation Products (m)

WebAcronym. Definition. PCHR. Palestinian Centre for Human Rights. PCHR. Personally Controlled Health Record (healthcare) PCHR. Philadelphia Commission on Human … WebMar 21, 2024 · GeneHancers around lnc-CYHR1-1 on the GeneHancer Hub at the UCSC Golden Path Genomic Locations for lnc-CYHR1-1 Gene Latest Assembly … five youngest presidentsWebPre-made anti-CYHR1 monoclonal antibody (mab) is expressed by mammalian cell line as a benchmark antibody for cell culture, ELISA or other affinity binding assay or functional assay development, animal model development, PK/PD model development (Pharmacokinetics & Pharmacodynamic). canker in chickens

"WebMar 1, 2011 · This CYHR1 fragment is almost as good a predictor of good response (receiver operating characteristic=0.91) as OSMR is a predictor of poor response (receiver operating characteristic=0.98). The current state of knowledge on CYHR1 is limited regarding its predicted protein structure, protein–protein interactions, subcellular … " - Cyhr1

Cyhr1

WebJul 1, 2004 · Background: Cysteine/histidine-rich 1 (CYHR1) was first discovered in a yeast two-hybrid screen with murine galectin-3, and no previous reports have described a relationship between the CYHR1 gene ... Webse_chr se_start se_end se_id cell_id se_rank se_ele_num se_cas_value se_con_value se_gene_overlap se_gene_proximal se_gene_closest se_gene_prestige se_gene_closest_active se_snp_n

Did you know?

WebCYHR1 in human cancer is unknown.16–19 To evaluate the role and signiﬁcance of CYHR1 in ESCC, we established CYHR1 knock-out esophageal cancer cells by using the small interfering RNA (siRNA) transfection method. Then, we performed a functional analysis, used reverse tran-scription-polymerase chain reaction (RT-PCR) to detect the WebMeaning. CVHR. Cyclic Variation of Heart Rate (cardiology) CVHR. Citizens' Voice for Health Rights (Canada) CVHR. Cardiovasculaire, Hémostase, Respiration (French: …

WebItem Human Cysteine and histidine rich protein 1 (CYHR1) ELISA Kit; Company MyBioSource.com; Price Pricing Info Supplier Page View Company Product Page; Catalog Number MBS7219175; Quantity 96 Strip Wells; Applications ELISA; Reactivity Human; Detection Target Cysteine and histidine rich protein 1 (CYHR1) Molecular Weight 22,766 … WebНачать обсуждение страницы «CYHR1». На страницах обсуждения люди обсуждают, как улучшить содержимое Wikipedia. Вы можете использовать эту страницу, чтобы обсудить с другими участниками, какие ...

WebInvitrogen Anti-CYHR1 Polyclonal, Catalog # PA5-66263. Tested in Western Blot (WB) and Immunocytochemistry (ICC/IF) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.05 mg/mL). WebProtein Description: cysteine/histidine-rich 1 Gene Name: CYHR1 Alternative Gene Name: CHRP, KIAA0496, MGC13010 Sequence: ASSPFPSSQCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQ Interspecies mouse/rat: ENSMUSG00000053929: 91%, ENSRNOG00000014811: 91% …

WebCYHR1 cysteine and histidine rich 1 Location: Also known as: KIAA0496, MGC13010, CHRP Ensembl: ENSG00000187954 NCBI Entrez Gene: 50626 Perturbation Effects …

WebInvitrogen Anti-CYHR1 Polyclonal, Catalog # PA5-62823. Tested in Immunocytochemistry (ICC/IF) and Immunohistochemistry (Paraffin) (IHC (P)) applications. This antibody reacts with Human samples. Supplied as 100 µL purified antibody (0.05 mg/mL). canker horseWebPharos is the web interface for data collected by the Illuminating the Druggable Genome initiative. Target, disease and ligand information are collected and displayed. five young girlsWebPrEST Antigen CYHR1 [Catalog No.: ATL-APrEST76449] Toggle menu. Compare ; Phone: 760-431-4600 / Fax: 760-431-4604; Sign in or Register; Cart 0. Search. CURRENT … canker in chineseWebEach montage below shows randomly selected individual cell images for the same target gene separated by sgRNA, along with an example montage of cells expressing a non-targeting negative control sgRNA at the bottom. sgRNA labels in the montages correspond to the numbered sgRNA sequences in the gene info table above. canker in back of throatWebCyhr1 cysteine and histidine rich 1 [ (house mouse)] Gene ID: 54151, updated on 8-Nov-2024 Summary Predicted to enable zinc ion binding activity. Located in cytoplasm and … five young menWebCYHR1 Antibody. Applications: ICC/IF, WB, IHC. Reactivity: Human, Mouse. Images: 5. Clonality: Polyclonal. Conjugates: Unconjugated. canker knifeWebCYHR1 Alias symbols CHRP, KIAA0496, MGC13010 %HI 61.63(Read more about the DECIPHER Haploinsufficiency Index) pLI 0.49(Read more about gnomAD pLI score) LOEUF 0.53(Read more about gnomAD LOEUF score) Cytoband 8q24.3 Genomic Coordinates. GRCh37/hg19: chr8:145674965-145691084: NCBI Ensembl UCSC: canker fungal disease